Diagenode

Human Recombinant His- and FLAG-tagged full-length DNMT1

default alt
Catalog Number
Format
Price
C23010114
25µg at 0,5µg /µl
$350.00

Full-length human recombinant DNMT1 (residues 2-1616 (C-terminus); Genbank Accession # NM_001379) expressed in Sf9 insect cells with an N-terminal His-tag and a C-terminal Flag-Tag.

 

  • Product Description

    Full lenght human DNMT1 recombinant protein

    Target description

    DNA methylation is recognized to play a major role in a number of cellular functions such as embryonic development, genetic imprinting, X chromosome inactivation and the control of gene expression. DNA methylation is generally associated with transcriptional repression. DNA (cytosine-5)-methyltransferase1 (DNMT1) preferentially methylates hemi-methylated DNA, in a CpG context, to maintain the methylation pattern in the new strand of replicated DNA.

    Full-length human recombinant DNMT1 (residues 2-1616 (C-terminus); Genbank Accession # NM_001379) expressed in Sf9 insect cells with an N-terminal His-tag and a C-terminal Flag-Tag. The molecular weight of the protein, including the His-tag and Flag-tag is 182 kDa.

    TExpression system: Baculovirus/ Sf9 insect cells

    Concentration

    25µg at 0,5µg /µl

    Specificity 

    Human

    Application 

    Recombinant DNMT1 is suitable for protein-protein interaction studies, DNA methylation assays, drug screening, structural studies, etc. 

    Storage Buffer

    25 μg recombinant DNMT1 protein supplied at a concentration of 0.5 μg/μl in 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 100mM EDTA pH 8, 0.01% NP-40, and 10% glycerol.

    Storage

    Recombinant proteins in solution are temperature sensitive and must be stored at -80°C to prevent degradation.

    Avoid repeated freeze/thaw cycles and keep on ice when not in storage.

    Precautions: This product is for research use only. Not for use in diagnostic or therapeutic procedures.

  • Quality Control

    Sequence:

          MHHHHHHLEPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKE                   KLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNRE                   VNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRRSKSDGEAKPEPSPSPRITRK                  STRQTTITSHFAKGPAKRKPQEESERAKSDESIKEEDKDQDEKRRRVTSRERVARPLP                   AEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQKLKEEPDREARAGVQADEDE                 DGDEKDEKKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTE                KKMARAKTVMNSKTHPPKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDAN                ESGFESYEALPQHKLTCFSVYCKHGHLCPIDTGLIEKNIELFFSGSAKPIYDDDPSLE               GGVNGKNLGPINEWWITGFDGGEKALIGFSTSFAEYILMDPSPEYAPIFGLMQEKIYI      SKIVVEFLQSNSDSTYEDLINKIETTVPPSGLNLNRFTEDSLLRHAQFVVEQVESYDE                 AGDSDEQPIFLTPCMRDLIKLAGVTLGQRRAQARRQTIRHSTREKDRGPTKATTTKLV                   YQIFDTFFAEQIEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDMVKFGGSGRS                   KQACQERRCPNMAMKEADDDEEVDDNIPEMPSPKKMHQGKKKKQNKNRISWVGEAVKT                  DGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFC                 AGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLE               GDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVLEQL                EDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEH                   YRKYSDYIKGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRVNKFYRPEN THKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMGGP                   NRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEI KLPKLRTLDVFSGCGGLSEGFHQAGISDTLWAIEMWDPAAQAFRLNNPGSTVFT EDCNILLKLVMAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSK FKNSLVVSFLSYCDYYRPRFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTF GVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKF VSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQ YQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYT HHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAG LYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLF GNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKDAAAD                                                                 YKDDDDK*

  • Documents
    DNMT1 recombinant protein DATASHEET
    DNMT1 recombinant protein datasheet
    Download
  • Publications

    How to properly cite this product in your work

    Diagenode strongly recommends using this: Human Recombinant His- and FLAG-tagged full-length DNMT1 (Diagenode Cat# C23010114). Click here to copy to clipboard.

    Using our products in your publication? Let us know!

Events

 See all events

Twitter feed

News

 See all news