Diagenode

Human Recombinant His- and FLAG-tagged full-length DNMT1

default alt
Catalog Number
Format
Price
C23010114
25µg at 0,5µg /µl
$360.00

Full-length human recombinant DNMT1 (residues 2-1616 (C-terminus); Genbank Accession # NM_001379) expressed in Sf9 insect cells with an N-terminal His-tag and a C-terminal Flag-Tag.

 

  • Product Description

    Full lenght human DNMT1 recombinant protein

    Target description

    DNA methylation is recognized to play a major role in a number of cellular functions such as embryonic development, genetic imprinting, X chromosome inactivation and the control of gene expression. DNA methylation is generally associated with transcriptional repression. DNA (cytosine-5)-methyltransferase1 (DNMT1) preferentially methylates hemi-methylated DNA, in a CpG context, to maintain the methylation pattern in the new strand of replicated DNA.

    Full-length human recombinant DNMT1 (residues 2-1616 (C-terminus); Genbank Accession # NM_001379) expressed in Sf9 insect cells with an N-terminal His-tag and a C-terminal Flag-Tag. The molecular weight of the protein, including the His-tag and Flag-tag is 182 kDa.

    TExpression system: Baculovirus/ Sf9 insect cells

    Concentration

    25µg at 0,5µg /µl

    Specificity 

    Human

    Application 

    Recombinant DNMT1 is suitable for protein-protein interaction studies, DNA methylation assays, drug screening, structural studies, etc. 

    Storage Buffer

    25 μg recombinant DNMT1 protein supplied at a concentration of 0.5 μg/μl in 20 mM Tris-HCl pH 7.5, 150 mM NaCl, 100mM EDTA pH 8, 0.01% NP-40, and 10% glycerol.

    Storage

    Recombinant proteins in solution are temperature sensitive and must be stored at -80°C to prevent degradation.

    Avoid repeated freeze/thaw cycles and keep on ice when not in storage.

    Precautions: This product is for research use only. Not for use in diagnostic or therapeutic procedures.

  • Quality Control

    Sequence:

          MHHHHHHLEPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKE                   KLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNRE                   VNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRRSKSDGEAKPEPSPSPRITRK                  STRQTTITSHFAKGPAKRKPQEESERAKSDESIKEEDKDQDEKRRRVTSRERVARPLP                   AEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQKLKEEPDREARAGVQADEDE                 DGDEKDEKKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTE                KKMARAKTVMNSKTHPPKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDAN                ESGFESYEALPQHKLTCFSVYCKHGHLCPIDTGLIEKNIELFFSGSAKPIYDDDPSLE               GGVNGKNLGPINEWWITGFDGGEKALIGFSTSFAEYILMDPSPEYAPIFGLMQEKIYI      SKIVVEFLQSNSDSTYEDLINKIETTVPPSGLNLNRFTEDSLLRHAQFVVEQVESYDE                 AGDSDEQPIFLTPCMRDLIKLAGVTLGQRRAQARRQTIRHSTREKDRGPTKATTTKLV                   YQIFDTFFAEQIEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDMVKFGGSGRS                   KQACQERRCPNMAMKEADDDEEVDDNIPEMPSPKKMHQGKKKKQNKNRISWVGEAVKT                  DGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFC                 AGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLE               GDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVLEQL                EDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEH                   YRKYSDYIKGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRVNKFYRPEN THKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMGGP                   NRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEI KLPKLRTLDVFSGCGGLSEGFHQAGISDTLWAIEMWDPAAQAFRLNNPGSTVFT EDCNILLKLVMAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSK FKNSLVVSFLSYCDYYRPRFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTF GVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKF VSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQ YQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYT HHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAG LYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLF GNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKDAAAD                                                                 YKDDDDK*

  • Documents
    DNMT1 recombinant protein DATASHEET
    DNMT1 recombinant protein datasheet
    Download
  • Publications

    How to properly cite this product in your work

    Diagenode strongly recommends using this: Human Recombinant His- and FLAG-tagged full-length DNMT1 (Diagenode Cat# C23010114). Click here to copy to clipboard.

    Using our products in your publication? Let us know!

Events

 See all events

Applications

 See all applications



The European Regional Development Fund and Wallonia are investing in your future.

Extension of industrial buildings and new laboratories.



  ABOUT SSL CERTIFICATES

         Site map   |   Contact us   |   Conditions of sales   |   Conditions of purchase   |   Privacy policy   |   Diagenode Diagnostics